LRRC45 polyclonal antibody Ver mas grande

LRRC45 polyclonal antibody

AB-PAB21563

Producto nuevo

LRRC45 polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 uL
Gene Name LRRC45
Gene Alias MGC20806
Gene Description leucine rich repeat containing 45
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq RTLWRLDLAGNNIPGDVLRAVEQAMGHSQDRLTTFQENQARTHVLSKEVQHLREEKSKQFLDLMETIDKQREEMAKSSRASAARV
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)<br>Western Blot (1:250-1:500)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRRC45.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 201255
Iso type IgG

Más información

Rabbit polyclonal antibody raised against recombinant LRRC45.

Consulta sobre un producto

LRRC45 polyclonal antibody

LRRC45 polyclonal antibody