LRRC45 polyclonal antibody
  • LRRC45 polyclonal antibody

LRRC45 polyclonal antibody

Ref: AB-PAB21563
LRRC45 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRRC45.
Información adicional
Size 100 uL
Gene Name LRRC45
Gene Alias MGC20806
Gene Description leucine rich repeat containing 45
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq RTLWRLDLAGNNIPGDVLRAVEQAMGHSQDRLTTFQENQARTHVLSKEVQHLREEKSKQFLDLMETIDKQREEMAKSSRASAARV
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRRC45.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 201255
Iso type IgG

Enviar un mensaje


LRRC45 polyclonal antibody

LRRC45 polyclonal antibody