LRRC45 polyclonal antibody View larger

Rabbit polyclonal antibody raised against recombinant LRRC45.

AB-PAB21563

New product

LRRC45 polyclonal antibody

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 100 uL
Gene Name LRRC45
Gene Alias MGC20806
Gene Description leucine rich repeat containing 45
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq RTLWRLDLAGNNIPGDVLRAVEQAMGHSQDRLTTFQENQARTHVLSKEVQHLREEKSKQFLDLMETIDKQREEMAKSSRASAARV
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)<br>Western Blot (1:250-1:500)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRRC45.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 201255
Iso type IgG

More info

Rabbit polyclonal antibody raised against recombinant LRRC45.

Enviar uma mensagem

Rabbit polyclonal antibody raised against recombinant LRRC45.

Rabbit polyclonal antibody raised against recombinant LRRC45.