SLC28A3 polyclonal antibody Ver mas grande

SLC28A3 polyclonal antibody

AB-PAB21556

Producto nuevo

SLC28A3 polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 uL
Gene Name SLC28A3
Gene Alias CNT3
Gene Description solute carrier family 28 (sodium-coupled nucleoside transporter), member 3
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MELRSTAAPRAEGYSNVGFQNEENFLENENTSGNNSIRSRAVQSREHTNTKQDEEQVTVEQDSPRNREHMEDDDEEMQQKGCLERRYDTVCGFCRKHKTTLRH
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC28A3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64078
Iso type IgG

Más información

Rabbit polyclonal antibody raised against recombinant SLC28A3.

Consulta sobre un producto

SLC28A3 polyclonal antibody

SLC28A3 polyclonal antibody