SLC28A3 polyclonal antibody
  • SLC28A3 polyclonal antibody

SLC28A3 polyclonal antibody

Ref: AB-PAB21556
SLC28A3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC28A3.
Información adicional
Size 100 uL
Gene Name SLC28A3
Gene Alias CNT3
Gene Description solute carrier family 28 (sodium-coupled nucleoside transporter), member 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MELRSTAAPRAEGYSNVGFQNEENFLENENTSGNNSIRSRAVQSREHTNTKQDEEQVTVEQDSPRNREHMEDDDEEMQQKGCLERRYDTVCGFCRKHKTTLRH
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC28A3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64078
Iso type IgG

Enviar uma mensagem


SLC28A3 polyclonal antibody

SLC28A3 polyclonal antibody