SLC38A10 polyclonal antibody
  • SLC38A10 polyclonal antibody

SLC38A10 polyclonal antibody

Ref: AB-PAB21542
SLC38A10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC38A10.
Información adicional
Size 100 uL
Gene Name SLC38A10
Gene Alias FLJ35718|MGC15523|PP1744
Gene Description solute carrier family 38, member 10
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MKPKQVSRDLGLAADLPGGAEGAAAQPQAVLRQPELRVISDGEQGGQQGHRLDHGGHLEMRKA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC38A10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 124565
Iso type IgG

Enviar un mensaje


SLC38A10 polyclonal antibody

SLC38A10 polyclonal antibody