SLC38A10 polyclonal antibody View larger

Rabbit polyclonal antibody raised against recombinant SLC38A10.

AB-PAB21542

New product

SLC38A10 polyclonal antibody

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 100 uL
Gene Name SLC38A10
Gene Alias FLJ35718|MGC15523|PP1744
Gene Description solute carrier family 38, member 10
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MKPKQVSRDLGLAADLPGGAEGAAAQPQAVLRQPELRVISDGEQGGQQGHRLDHGGHLEMRKA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC38A10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 124565
Iso type IgG

More info

Rabbit polyclonal antibody raised against recombinant SLC38A10.

Enviar uma mensagem

Rabbit polyclonal antibody raised against recombinant SLC38A10.

Rabbit polyclonal antibody raised against recombinant SLC38A10.