R3HCC1 polyclonal antibody Ver mas grande

R3HCC1 polyclonal antibody

AB-PAB21530

Producto nuevo

R3HCC1 polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 uL
Gene Name R3HCC1
Gene Alias DKFZp564N123
Gene Description R3H domain and coiled-coil containing 1
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DQPLYVPRVLRKQEEWGLTSTSVLKREAPAGRDPEEPGDVGAGDPNSDQGLPVLMTQGTEDLKGPGQRCENEPLLD
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human R3HCC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 203069
Iso type IgG

Más información

Rabbit polyclonal antibody raised against recombinant R3HCC1.

Consulta sobre un producto

R3HCC1 polyclonal antibody

R3HCC1 polyclonal antibody