R3HCC1 polyclonal antibody
  • R3HCC1 polyclonal antibody

R3HCC1 polyclonal antibody

Ref: AB-PAB21530
R3HCC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant R3HCC1.
Información adicional
Size 100 uL
Gene Name R3HCC1
Gene Alias DKFZp564N123
Gene Description R3H domain and coiled-coil containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DQPLYVPRVLRKQEEWGLTSTSVLKREAPAGRDPEEPGDVGAGDPNSDQGLPVLMTQGTEDLKGPGQRCENEPLLD
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human R3HCC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 203069
Iso type IgG

Enviar uma mensagem


R3HCC1 polyclonal antibody

R3HCC1 polyclonal antibody