C9orf97 polyclonal antibody Ver mas grande

C9orf97 polyclonal antibody

AB-PAB21500

Producto nuevo

C9orf97 polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 uL
Gene Name C9orf97
Gene Alias FLJ36724
Gene Description chromosome 9 open reading frame 97
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MPSSTSPDQGDDLENCILRFSDLDLKDMSLINPSSSLKAELDGSTKKKYSFAKKKAFALFVKTKEVPTKRSFECKEKLWKCCQQLFTDQTSIHRHVATQHADEIYHQT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C9orf97.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 158427
Iso type IgG

Más información

Rabbit polyclonal antibody raised against recombinant C9orf97.

Consulta sobre un producto

C9orf97 polyclonal antibody

C9orf97 polyclonal antibody