C9orf97 polyclonal antibody
  • C9orf97 polyclonal antibody

C9orf97 polyclonal antibody

Ref: AB-PAB21500
C9orf97 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C9orf97.
Información adicional
Size 100 uL
Gene Name C9orf97
Gene Alias FLJ36724
Gene Description chromosome 9 open reading frame 97
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MPSSTSPDQGDDLENCILRFSDLDLKDMSLINPSSSLKAELDGSTKKKYSFAKKKAFALFVKTKEVPTKRSFECKEKLWKCCQQLFTDQTSIHRHVATQHADEIYHQT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C9orf97.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 158427
Iso type IgG

Enviar uma mensagem


C9orf97 polyclonal antibody

C9orf97 polyclonal antibody