SLFN13 polyclonal antibody Ver mas grande

SLFN13 polyclonal antibody

AB-PAB21499

Producto nuevo

SLFN13 polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 100 uL
Gene Name SLFN13
Gene Alias DKFZp666J196|DKFZp686I026|FLJ31952|SLFN10
Gene Description schlafen family member 13
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VLGCAKEQVDPDSLKNVIARAISKLPIVHFCSSKPRVEYSTKIVEVFCGKELYGYLCVIKVKAFCCVVFSEAPK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLFN13.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 146857
Iso type IgG

Más información

Rabbit polyclonal antibody raised against recombinant SLFN13.

Consulta sobre un producto

SLFN13 polyclonal antibody

SLFN13 polyclonal antibody