SLFN13 polyclonal antibody View larger

Rabbit polyclonal antibody raised against recombinant SLFN13.

AB-PAB21499

New product

SLFN13 polyclonal antibody

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 100 uL
Gene Name SLFN13
Gene Alias DKFZp666J196|DKFZp686I026|FLJ31952|SLFN10
Gene Description schlafen family member 13
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VLGCAKEQVDPDSLKNVIARAISKLPIVHFCSSKPRVEYSTKIVEVFCGKELYGYLCVIKVKAFCCVVFSEAPK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLFN13.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 146857
Iso type IgG

More info

Rabbit polyclonal antibody raised against recombinant SLFN13.

Enviar uma mensagem

Rabbit polyclonal antibody raised against recombinant SLFN13.

Rabbit polyclonal antibody raised against recombinant SLFN13.