GARNL4 polyclonal antibody
  • GARNL4 polyclonal antibody

GARNL4 polyclonal antibody

Ref: AB-PAB21479
GARNL4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GARNL4.
Información adicional
Size 100 uL
Gene Name GARNL4
Gene Alias DKFZp686O238|KIAA1039|RAP1GA3|Rap1GAP2
Gene Description GTPase activating Rap/RanGAP domain-like 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MFGRKRSVSFGGFGWIDKTMLASLKVKKQELANSSDATLPDRPLSPPLTAPPTMKSSEFFEMLEKMQGIKLEEQKPGPQKNKDDYIPYPSIDEVVEKGGPYPQVI
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GARNL4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23108
Iso type IgG

Enviar un mensaje


GARNL4 polyclonal antibody

GARNL4 polyclonal antibody