GARNL4 polyclonal antibody View larger

Rabbit polyclonal antibody raised against recombinant GARNL4.

AB-PAB21479

New product

GARNL4 polyclonal antibody

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 100 uL
Gene Name GARNL4
Gene Alias DKFZp686O238|KIAA1039|RAP1GA3|Rap1GAP2
Gene Description GTPase activating Rap/RanGAP domain-like 4
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MFGRKRSVSFGGFGWIDKTMLASLKVKKQELANSSDATLPDRPLSPPLTAPPTMKSSEFFEMLEKMQGIKLEEQKPGPQKNKDDYIPYPSIDEVVEKGGPYPQVI
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GARNL4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23108
Iso type IgG

More info

Rabbit polyclonal antibody raised against recombinant GARNL4.

Enviar uma mensagem

Rabbit polyclonal antibody raised against recombinant GARNL4.

Rabbit polyclonal antibody raised against recombinant GARNL4.