FHOD3 polyclonal antibody
  • FHOD3 polyclonal antibody

FHOD3 polyclonal antibody

Ref: AB-PAB21458
FHOD3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FHOD3.
Información adicional
Size 100 uL
Gene Name FHOD3
Gene Alias FHOS2|Formactin2
Gene Description formin homology 2 domain containing 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GVDTELLVYAMTLVNKTLSGLPDQDTFYDVVDCLEELGIAAVSQRHLNKKGTDLDLVEQLNIYEVALRHEDGDETTEPPPSGCRDRRRASVCSSGGGEHRGLDRRRSRRHSVQSIKSTLSAPTSPCSQSAPSFKPNQV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FHOD3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80206
Iso type IgG

Enviar un mensaje


FHOD3 polyclonal antibody

FHOD3 polyclonal antibody