FHOD3 polyclonal antibody View larger

Rabbit polyclonal antibody raised against recombinant FHOD3.

AB-PAB21458

New product

FHOD3 polyclonal antibody

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 100 uL
Gene Name FHOD3
Gene Alias FHOS2|Formactin2
Gene Description formin homology 2 domain containing 3
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GVDTELLVYAMTLVNKTLSGLPDQDTFYDVVDCLEELGIAAVSQRHLNKKGTDLDLVEQLNIYEVALRHEDGDETTEPPPSGCRDRRRASVCSSGGGEHRGLDRRRSRRHSVQSIKSTLSAPTSPCSQSAPSFKPNQV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FHOD3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80206
Iso type IgG

More info

Rabbit polyclonal antibody raised against recombinant FHOD3.

Enviar uma mensagem

Rabbit polyclonal antibody raised against recombinant FHOD3.

Rabbit polyclonal antibody raised against recombinant FHOD3.