RBM48 polyclonal antibody  Ver mas grande

RBM48 polyclonal antibody

AB-PAB21452

Producto nuevo

RBM48 polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 uL
Gene Name RBM48
Gene Alias C7orf64|DKFZP564O0523|HSPC304
Gene Description RNA binding motif protein 48
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq MDEQSFFGGLLHVCYAPEFETVEETRKKLQMRKAYVVKTTENKDHYVTKKKLVTEHKDTEDFRQDFHSEMSGF
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)<br>Immunofluorescence (1-4 ug/mL)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RBM48.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84060
Iso type IgG

Más información

Rabbit polyclonal antibody raised against recombinant RBM48.

Consulta sobre un producto

RBM48 polyclonal antibody

RBM48 polyclonal antibody