RBM48 polyclonal antibody
  • RBM48 polyclonal antibody

RBM48 polyclonal antibody

Ref: AB-PAB21452
RBM48 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RBM48.
Información adicional
Size 100 uL
Gene Name RBM48
Gene Alias C7orf64|DKFZP564O0523|HSPC304
Gene Description RNA binding motif protein 48
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq MDEQSFFGGLLHVCYAPEFETVEETRKKLQMRKAYVVKTTENKDHYVTKKKLVTEHKDTEDFRQDFHSEMSGF
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RBM48.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84060
Iso type IgG

Enviar uma mensagem


RBM48 polyclonal antibody

RBM48 polyclonal antibody