ACLY polyclonal antibody
  • ACLY polyclonal antibody

ACLY polyclonal antibody

Ref: AB-PAB21446
ACLY polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ACLY.
Información adicional
Size 100 uL
Gene Name ACLY
Gene Alias ACL|ATPCL|CLATP
Gene Description ATP citrate lyase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq CANQASETAVAKNQALKEAGVFVPRSFDELGEIIQSVYEDLVANGVIVPAQEVPPPTVPMDYSWARELGLIRKPASFMTSICDERGQELIYAGMPITE
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ACLY.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 47
Iso type IgG

Enviar un mensaje


ACLY polyclonal antibody

ACLY polyclonal antibody