ACLY polyclonal antibody View larger

Rabbit polyclonal antibody raised against recombinant ACLY.

AB-PAB21446

New product

ACLY polyclonal antibody

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 100 uL
Gene Name ACLY
Gene Alias ACL|ATPCL|CLATP
Gene Description ATP citrate lyase
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq CANQASETAVAKNQALKEAGVFVPRSFDELGEIIQSVYEDLVANGVIVPAQEVPPPTVPMDYSWARELGLIRKPASFMTSICDERGQELIYAGMPITE
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)<br>Western Blot (1:250-1:500)<br>Immunofluorescence (1-4 ug/mL)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ACLY.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 47
Iso type IgG

More info

Rabbit polyclonal antibody raised against recombinant ACLY.

Enviar uma mensagem

Rabbit polyclonal antibody raised against recombinant ACLY.

Rabbit polyclonal antibody raised against recombinant ACLY.