ANKRD40 polyclonal antibody Ver mas grande

ANKRD40 polyclonal antibody

AB-PAB21444

Producto nuevo

ANKRD40 polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 uL
Gene Name ANKRD40
Gene Alias DKFZp451K241|MGC15396
Gene Description ankyrin repeat domain 40
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq NDFIEIELDRQELTYQELLRVCCCELGVNPDQVEKIRKLPNTLLRKDKDVARLQDFQELELVLMISENNFLFRNAASTLTERPCYNRRAS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ANKRD40.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 91369
Iso type IgG

Más información

Rabbit polyclonal antibody raised against recombinant ANKRD40.

Consulta sobre un producto

ANKRD40 polyclonal antibody

ANKRD40 polyclonal antibody