ANKRD40 polyclonal antibody View larger

Rabbit polyclonal antibody raised against recombinant ANKRD40.

AB-PAB21444

New product

ANKRD40 polyclonal antibody

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 100 uL
Gene Name ANKRD40
Gene Alias DKFZp451K241|MGC15396
Gene Description ankyrin repeat domain 40
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq NDFIEIELDRQELTYQELLRVCCCELGVNPDQVEKIRKLPNTLLRKDKDVARLQDFQELELVLMISENNFLFRNAASTLTERPCYNRRAS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ANKRD40.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 91369
Iso type IgG

More info

Rabbit polyclonal antibody raised against recombinant ANKRD40.

Enviar uma mensagem

Rabbit polyclonal antibody raised against recombinant ANKRD40.

Rabbit polyclonal antibody raised against recombinant ANKRD40.