ANKRD40 polyclonal antibody
  • ANKRD40 polyclonal antibody

ANKRD40 polyclonal antibody

Ref: AB-PAB21444
ANKRD40 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ANKRD40.
Información adicional
Size 100 uL
Gene Name ANKRD40
Gene Alias DKFZp451K241|MGC15396
Gene Description ankyrin repeat domain 40
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq NDFIEIELDRQELTYQELLRVCCCELGVNPDQVEKIRKLPNTLLRKDKDVARLQDFQELELVLMISENNFLFRNAASTLTERPCYNRRAS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ANKRD40.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 91369
Iso type IgG

Enviar uma mensagem


ANKRD40 polyclonal antibody

ANKRD40 polyclonal antibody