FAM78A polyclonal antibody Ver mas grande

FAM78A polyclonal antibody

AB-PAB21415

Producto nuevo

FAM78A polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 uL
Gene Name FAM78A
Gene Alias C9orf59|FLJ00024
Gene Description family with sequence similarity 78, member A
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FTTWLVATNTSTNDMIILQTLHWRMQLSIEVNPNRPLGQRARLREPIAQDQPKILSKNEPIP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM78A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 286336
Iso type IgG

Más información

Rabbit polyclonal antibody raised against recombinant FAM78A.

Consulta sobre un producto

FAM78A polyclonal antibody

FAM78A polyclonal antibody