FAM78A polyclonal antibody
  • FAM78A polyclonal antibody

FAM78A polyclonal antibody

Ref: AB-PAB21415
FAM78A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM78A.
Información adicional
Size 100 uL
Gene Name FAM78A
Gene Alias C9orf59|FLJ00024
Gene Description family with sequence similarity 78, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FTTWLVATNTSTNDMIILQTLHWRMQLSIEVNPNRPLGQRARLREPIAQDQPKILSKNEPIP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM78A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 286336
Iso type IgG

Enviar uma mensagem


FAM78A polyclonal antibody

FAM78A polyclonal antibody