YIF1A polyclonal antibody Ver mas grande

YIF1A polyclonal antibody

AB-PAB20773

Producto nuevo

YIF1A polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 uL
Gene Name YIF1A
Gene Alias 54TM|FinGER7|YIF1|YIF1P
Gene Description Yip1 interacting factor homolog A (S. cerevisiae)
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq ALMYFIVRSLRTAALGPDSMGGPVPRQRLQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)<br>Western Blot (1:250-1:500)<br>Immunofluorescence (1-4 ug/mL)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human YIF1A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10897
Iso type IgG

Más información

Rabbit polyclonal antibody raised against recombinant YIF1A.

Consulta sobre un producto

YIF1A polyclonal antibody

YIF1A polyclonal antibody