YIF1A polyclonal antibody
  • YIF1A polyclonal antibody

YIF1A polyclonal antibody

Ref: AB-PAB20773
YIF1A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant YIF1A.
Información adicional
Size 100 uL
Gene Name YIF1A
Gene Alias 54TM|FinGER7|YIF1|YIF1P
Gene Description Yip1 interacting factor homolog A (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq ALMYFIVRSLRTAALGPDSMGGPVPRQRLQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human YIF1A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10897
Iso type IgG

Enviar un mensaje


YIF1A polyclonal antibody

YIF1A polyclonal antibody