View larger
Rabbit polyclonal antibody raised against recombinant YIF1A.
AB-PAB20773
New product
YIF1A polyclonal antibody
Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.
Data sheet
| Size | 100 uL |
| Gene Name | YIF1A |
| Gene Alias | 54TM|FinGER7|YIF1|YIF1P |
| Gene Description | Yip1 interacting factor homolog A (S. cerevisiae) |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB,IHC-P,IF |
| Immunogen Prot. Seq | ALMYFIVRSLRTAALGPDSMGGPVPRQRLQ |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (1:50-1:200)<br>Western Blot (1:250-1:500)<br>Immunofluorescence (1-4 ug/mL)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to amino acids of human YIF1A. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Gene ID | 10897 |
| Iso type | IgG |
More info
Rabbit polyclonal antibody raised against recombinant YIF1A.