C9orf46 polyclonal antibody Ver mas grande

C9orf46 polyclonal antibody

AB-PAB20414

Producto nuevo

C9orf46 polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 uL
Gene Name C9orf46
Gene Alias AD025|FLJ14688|FLJ39176|MDS030
Gene Description chromosome 9 open reading frame 46
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq QKEFMLMNARLQLERQLIMQSEMRERQMAMQIAWSRE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)<br>Western Blot (1:250-1:500)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C9orf46.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55848
Iso type IgG

Más información

Rabbit polyclonal antibody raised against recombinant C9orf46.

Consulta sobre un producto

C9orf46 polyclonal antibody

C9orf46 polyclonal antibody