C9orf46 polyclonal antibody
  • C9orf46 polyclonal antibody

C9orf46 polyclonal antibody

Ref: AB-PAB20414
C9orf46 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C9orf46.
Información adicional
Size 100 uL
Gene Name C9orf46
Gene Alias AD025|FLJ14688|FLJ39176|MDS030
Gene Description chromosome 9 open reading frame 46
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq QKEFMLMNARLQLERQLIMQSEMRERQMAMQIAWSRE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C9orf46.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55848
Iso type IgG

Enviar uma mensagem


C9orf46 polyclonal antibody

C9orf46 polyclonal antibody