DRG2 polyclonal antibody Ver mas grande

DRG2 polyclonal antibody

AB-PAB20391

Producto nuevo

DRG2 polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 uL
Gene Name DRG2
Gene Alias -
Gene Description developmentally regulated GTP binding protein 2
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq YKIFNAEVLFREDCSPDEFIDVIVGNRVYMPCLYVYNKIDQISMEEVDRLARKPNSVVISCGMKLNLDYLLEMLWEYLALTCIYTKKRGQRPDFTDAIILRKGASVEHVCHRIHRSLASQFKYALVWGTSTKYSPQRVGLTHTMEHEDVI
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)<br>Immunofluorescence (1-4 ug/mL)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DRG2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1819
Iso type IgG

Más información

Rabbit polyclonal antibody raised against recombinant DRG2.

Consulta sobre un producto

DRG2 polyclonal antibody

DRG2 polyclonal antibody