DRG2 polyclonal antibody
  • DRG2 polyclonal antibody

DRG2 polyclonal antibody

Ref: AB-PAB20391
DRG2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DRG2.
Información adicional
Size 100 uL
Gene Name DRG2
Gene Alias -
Gene Description developmentally regulated GTP binding protein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq YKIFNAEVLFREDCSPDEFIDVIVGNRVYMPCLYVYNKIDQISMEEVDRLARKPNSVVISCGMKLNLDYLLEMLWEYLALTCIYTKKRGQRPDFTDAIILRKGASVEHVCHRIHRSLASQFKYALVWGTSTKYSPQRVGLTHTMEHEDVI
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DRG2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1819
Iso type IgG

Enviar uma mensagem


DRG2 polyclonal antibody

DRG2 polyclonal antibody