Ver mas grande
TPPP2 polyclonal antibody
AB-PAB20264
Producto nuevo
TPPP2 polyclonal antibody
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | TPPP2 |
| Gene Alias | C14orf8|P18|p25beta |
| Gene Description | tubulin polymerization-promoting protein family member 2 |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,IHC-P |
| Immunogen Prot. Seq | TFHRFAAFGESSSSGTEMNNKNFSKLCKDCGIMDGKTVTSTDVDIVFSKVKAKNARTITFQQFKEAVKELGQKRFKGKSPDEVLENIYGLMEGKDPATTGATKATTVGAVDRLTDTSKYTGTHKERFDESGKGKGIAGREEMT |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (1:50-1:200)<br>Western Blot (1:250-1:500)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to amino acids of human TPPP2. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Gene ID | 122664 |
| Iso type | IgG |
Más información
Rabbit polyclonal antibody raised against recombinant TPPP2.