TPPP2 polyclonal antibody
  • TPPP2 polyclonal antibody

TPPP2 polyclonal antibody

Ref: AB-PAB20264
TPPP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TPPP2.
Información adicional
Size 100 uL
Gene Name TPPP2
Gene Alias C14orf8|P18|p25beta
Gene Description tubulin polymerization-promoting protein family member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq TFHRFAAFGESSSSGTEMNNKNFSKLCKDCGIMDGKTVTSTDVDIVFSKVKAKNARTITFQQFKEAVKELGQKRFKGKSPDEVLENIYGLMEGKDPATTGATKATTVGAVDRLTDTSKYTGTHKERFDESGKGKGIAGREEMT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TPPP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 122664
Iso type IgG

Enviar uma mensagem


TPPP2 polyclonal antibody

TPPP2 polyclonal antibody