SLC6A14 polyclonal antibody
  • SLC6A14 polyclonal antibody

SLC6A14 polyclonal antibody

Ref: AB-PAB20176
SLC6A14 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC6A14.
Información adicional
Size 100 uL
Gene Name SLC6A14
Gene Alias ATB(0+)|BMIQ11
Gene Description solute carrier family 6 (amino acid transporter), member 14
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC6A14.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 11254
Iso type IgG

Enviar un mensaje


SLC6A14 polyclonal antibody

SLC6A14 polyclonal antibody