AB-PAB20176
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.
Size | 100 uL |
Gene Name | SLC6A14 |
Gene Alias | ATB(0+)|BMIQ11 |
Gene Description | solute carrier family 6 (amino acid transporter), member 14 |
Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Application Key | IHC-P |
Immunogen Prot. Seq | FQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETG |
Form | Liquid |
Recomended Dilution | Immunohistochemistry (1:200-1:500)<br>The optimal working dilution should be determined by the end user. |
Antigen species Target species | Human |
Immunogen | Recombinant protein corresponding to amino acids of human SLC6A14. |
Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Gene ID | 11254 |
Iso type | IgG |