Ver mas grande
PPP1R1C purified MaxPab mouse polyclonal antibody (B01P)
AB-H00151242-B01P
Producto nuevo
PPP1R1C purified MaxPab mouse polyclonal antibody (B01P)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | PPP1R1C |
| Gene Alias | IPP5 |
| Gene Description | protein phosphatase 1, regulatory (inhibitor) subunit 1C |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr |
| Immunogen Prot. Seq | MEPNSPKKIQFAVPVFQSQIAPEAAEQIRKRRPTPASLVILNEHNPPEIDDKRGPNTQGELQNASPKQRKQSVYTPPTIKGVKHLKGQNESAFPEEEEGTNEREEQRDH |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | PPP1R1C (NP_001074014.1, 1 a.a. ~ 109 a.a) full-length human protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 151242 |
Más información
Mouse polyclonal antibody raised against a full-length human PPP1R1C protein.