PPP1R1C purified MaxPab mouse polyclonal antibody (B01P)
  • PPP1R1C purified MaxPab mouse polyclonal antibody (B01P)

PPP1R1C purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00151242-B01P
PPP1R1C purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PPP1R1C protein.
Información adicional
Size 50 ug
Gene Name PPP1R1C
Gene Alias IPP5
Gene Description protein phosphatase 1, regulatory (inhibitor) subunit 1C
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEPNSPKKIQFAVPVFQSQIAPEAAEQIRKRRPTPASLVILNEHNPPEIDDKRGPNTQGELQNASPKQRKQSVYTPPTIKGVKHLKGQNESAFPEEEEGTNEREEQRDH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PPP1R1C (NP_001074014.1, 1 a.a. ~ 109 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 151242

Enviar uma mensagem


PPP1R1C purified MaxPab mouse polyclonal antibody (B01P)

PPP1R1C purified MaxPab mouse polyclonal antibody (B01P)