TP53RK monoclonal antibody (M03), clone 3A1 Ver mas grande

TP53RK monoclonal antibody (M03), clone 3A1

AB-H00112858-M03

Producto nuevo

TP53RK monoclonal antibody (M03), clone 3A1

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 50 ug
Gene Name TP53RK
Gene Alias BUD32|C20orf64|Nori-2|Nori-2p|PRPK|dJ101A2
Gene Description TP53 regulating kinase
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq HDEDLIHGDLTTSNMLLKPPLEQLNIVLIDFGLSFISALPEDKGVDLYVLEKAFLSTHPNTETVFEAFLKSYSTSSKKARPVLKKLDEVRLRGRKRSMVG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TP53RK (AAH09727, 154 a.a. ~ 253 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 112858
Clone Number 3A1
Iso type IgG2b Kappa

Más información

Mouse monoclonal antibody raised against a partial recombinant TP53RK.

Consulta sobre un producto

TP53RK monoclonal antibody (M03), clone 3A1

TP53RK monoclonal antibody (M03), clone 3A1