TP53RK monoclonal antibody (M03), clone 3A1 View larger

Mouse monoclonal antibody raised against a partial recombinant TP53RK.

AB-H00112858-M03

New product

TP53RK monoclonal antibody (M03), clone 3A1

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 50 ug
Gene Name TP53RK
Gene Alias BUD32|C20orf64|Nori-2|Nori-2p|PRPK|dJ101A2
Gene Description TP53 regulating kinase
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq HDEDLIHGDLTTSNMLLKPPLEQLNIVLIDFGLSFISALPEDKGVDLYVLEKAFLSTHPNTETVFEAFLKSYSTSSKKARPVLKKLDEVRLRGRKRSMVG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TP53RK (AAH09727, 154 a.a. ~ 253 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 112858
Clone Number 3A1
Iso type IgG2b Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant TP53RK.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant TP53RK.

Mouse monoclonal antibody raised against a partial recombinant TP53RK.