ACAD11 polyclonal antibody (A01)
  • ACAD11 polyclonal antibody (A01)

ACAD11 polyclonal antibody (A01)

Ref: AB-H00084129-A01
ACAD11 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ACAD11.
Información adicional
Size 50 uL
Gene Name ACAD11
Gene Alias FLJ12592|MGC150619
Gene Description acyl-Coenzyme A dehydrogenase family, member 11
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq RIAIEKIRLLTLKAAHSMDTLGSAGAKKEIAMIKVAAPRAVSKIVDWAIQVCGGAGVSQDYPLANMYAITRVLRLADGPDEVHLSAIATMELRDQAKRLTAKI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ACAD11 (NP_115545, 678 a.a. ~ 780 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 84129

Enviar un mensaje


ACAD11 polyclonal antibody (A01)

ACAD11 polyclonal antibody (A01)