Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ACAD11 polyclonal antibody (A01)
Abnova
ACAD11 polyclonal antibody (A01)
Ref: AB-H00084129-A01
ACAD11 polyclonal antibody (A01)
Contacte-nos
Información del producto
Mouse polyclonal antibody raised against a partial recombinant ACAD11.
Información adicional
Size
50 uL
Gene Name
ACAD11
Gene Alias
FLJ12592|MGC150619
Gene Description
acyl-Coenzyme A dehydrogenase family, member 11
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq
RIAIEKIRLLTLKAAHSMDTLGSAGAKKEIAMIKVAAPRAVSKIVDWAIQVCGGAGVSQDYPLANMYAITRVLRLADGPDEVHLSAIATMELRDQAKRLTAKI
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ACAD11 (NP_115545, 678 a.a. ~ 780 a.a) partial recombinant protein with GST tag.
Storage Buffer
50 % glycerol
Gene ID
84129
Enviar uma mensagem
ACAD11 polyclonal antibody (A01)
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*