ZIC4 monoclonal antibody (M13), clone 3H6 Ver mas grande

ZIC4 monoclonal antibody (M13), clone 3H6

AB-H00084107-M13

Producto nuevo

ZIC4 monoclonal antibody (M13), clone 3H6

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Gene Name ZIC4
Gene Alias FLJ42609|FLJ45833
Gene Description Zic family member 4
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA,IF
Immunogen Prot. Seq MRYKTSLVMRKRLRLYRNTLKESSSSSGHHGPQLTAASSPSVFPGLHEEPPQASPSRPLNGLLRLGLPGDMYARPEPFPPGPAARSDALA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZIC4 (NP_115529, 1 a.a. ~ 90 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 84107
Clone Number 3H6
Iso type IgG2b Kappa

Más información

Mouse monoclonal antibody raised against a full length recombinant ZIC4.

Consulta sobre un producto

ZIC4 monoclonal antibody (M13), clone 3H6

ZIC4 monoclonal antibody (M13), clone 3H6