View larger
Mouse monoclonal antibody raised against a full length recombinant ZIC4.
AB-H00084107-M13
New product
ZIC4 monoclonal antibody (M13), clone 3H6
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | ZIC4 |
| Gene Alias | FLJ42609|FLJ45833 |
| Gene Description | Zic family member 4 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,ELISA,IF |
| Immunogen Prot. Seq | MRYKTSLVMRKRLRLYRNTLKESSSSSGHHGPQLTAASSPSVFPGLHEEPPQASPSRPLNGLLRLGLPGDMYARPEPFPPGPAARSDALA |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | ZIC4 (NP_115529, 1 a.a. ~ 90 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 84107 |
| Clone Number | 3H6 |
| Iso type | IgG2b Kappa |
More info
Mouse monoclonal antibody raised against a full length recombinant ZIC4.