ZIC4 monoclonal antibody (M13), clone 3H6
  • ZIC4 monoclonal antibody (M13), clone 3H6

ZIC4 monoclonal antibody (M13), clone 3H6

Ref: AB-H00084107-M13
ZIC4 monoclonal antibody (M13), clone 3H6

Información del producto

Mouse monoclonal antibody raised against a full length recombinant ZIC4.
Información adicional
Size 100 ug
Gene Name ZIC4
Gene Alias FLJ42609|FLJ45833
Gene Description Zic family member 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA,IF
Immunogen Prot. Seq MRYKTSLVMRKRLRLYRNTLKESSSSSGHHGPQLTAASSPSVFPGLHEEPPQASPSRPLNGLLRLGLPGDMYARPEPFPPGPAARSDALA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZIC4 (NP_115529, 1 a.a. ~ 90 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 84107
Clone Number 3H6
Iso type IgG2b Kappa

Enviar uma mensagem


ZIC4 monoclonal antibody (M13), clone 3H6

ZIC4 monoclonal antibody (M13), clone 3H6