Ver mas grande
CABLES2 polyclonal antibody (A01)
AB-H00081928-A01
Producto nuevo
CABLES2 polyclonal antibody (A01)
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | CABLES2 |
| Gene Alias | C20orf150|dJ908M14.2|ik3-2 |
| Gene Description | Cdk5 and Abl enzyme substrate 2 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | LEFLEDAVGCAPAQRTKHTSGSPRHKGLKKTHFIKNMRQYDTRNSRIVLICAKRSLCAAFSVLPYGEGLRISDLRVDSQKQRHPSGGVSVSSEMVFELEGVELGADGKV |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | CABLES2 (NP_112492, 131 a.a. ~ 239 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 81928 |
Más información
Mouse polyclonal antibody raised against a partial recombinant CABLES2.