AB-H00081928-A01
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Size | 50 uL |
Gene Name | CABLES2 |
Gene Alias | C20orf150|dJ908M14.2|ik3-2 |
Gene Description | Cdk5 and Abl enzyme substrate 2 |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Application Key | WB-Re,ELISA |
Immunogen Prot. Seq | LEFLEDAVGCAPAQRTKHTSGSPRHKGLKKTHFIKNMRQYDTRNSRIVLICAKRSLCAAFSVLPYGEGLRISDLRVDSQKQRHPSGGVSVSSEMVFELEGVELGADGKV |
Antigen species Target species | Human |
Quality control testing | Antibody Reactive Against Recombinant Protein. |
Immunogen | CABLES2 (NP_112492, 131 a.a. ~ 239 a.a) partial recombinant protein with GST tag. |
Storage Buffer | 50 % glycerol |
Gene ID | 81928 |