CABLES2 polyclonal antibody (A01)
  • CABLES2 polyclonal antibody (A01)

CABLES2 polyclonal antibody (A01)

Ref: AB-H00081928-A01
CABLES2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CABLES2.
Información adicional
Size 50 uL
Gene Name CABLES2
Gene Alias C20orf150|dJ908M14.2|ik3-2
Gene Description Cdk5 and Abl enzyme substrate 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LEFLEDAVGCAPAQRTKHTSGSPRHKGLKKTHFIKNMRQYDTRNSRIVLICAKRSLCAAFSVLPYGEGLRISDLRVDSQKQRHPSGGVSVSSEMVFELEGVELGADGKV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CABLES2 (NP_112492, 131 a.a. ~ 239 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 81928

Enviar uma mensagem


CABLES2 polyclonal antibody (A01)

CABLES2 polyclonal antibody (A01)