BCL2L14 purified MaxPab rabbit polyclonal antibody (D01P)
  • BCL2L14 purified MaxPab rabbit polyclonal antibody (D01P)

BCL2L14 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00079370-D01P
BCL2L14 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

BCL2L14 purified MaxPab rabbit polyclonal antibody (D01P)
Información adicional
Size 100 ug
Gene Name BCL2L14
Gene Alias BCLG
Gene Description BCL2-like 14 (apoptosis facilitator)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BCL2L14 (NP_620048.1, 1 a.a. ~ 327 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79370

Enviar un mensaje


BCL2L14 purified MaxPab rabbit polyclonal antibody (D01P)

BCL2L14 purified MaxPab rabbit polyclonal antibody (D01P)