BCL2L14 purified MaxPab rabbit polyclonal antibody (D01P)
  • BCL2L14 purified MaxPab rabbit polyclonal antibody (D01P)

BCL2L14 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00079370-D01P
BCL2L14 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human BCL2L14 protein.
Información adicional
Size 100 ug
Gene Name BCL2L14
Gene Alias BCLG
Gene Description BCL2-like 14 (apoptosis facilitator)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BCL2L14 (NP_620048.1, 1 a.a. ~ 327 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79370

Enviar uma mensagem


BCL2L14 purified MaxPab rabbit polyclonal antibody (D01P)

BCL2L14 purified MaxPab rabbit polyclonal antibody (D01P)