ACD monoclonal antibody (M01), clone 1C11-1A7
  • ACD monoclonal antibody (M01), clone 1C11-1A7

ACD monoclonal antibody (M01), clone 1C11-1A7

Ref: AB-H00065057-M01
ACD monoclonal antibody (M01), clone 1C11-1A7

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant ACD.
Información adicional
Size 100 ug
Gene Name ACD
Gene Alias PIP1|PTOP|TINT1|TPP1
Gene Description adrenocortical dysplasia homolog (mouse)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq MPGRCQSDAAMRVNGPASRAPAGWTSGSLHTGPRAGRPRAQARGVRGRGLLLRPRPAKELPLPRKGGAWAPAGNPGPLHPLGVAVGMAGSGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPRLRVPGCNQDLDVQKKLYDCLEEHLSESTSSNAGLSLS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ACD (AAH16904, 1 a.a. ~ 544 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 65057
Clone Number 1C11-1A7
Iso type IgG1 Kappa

Enviar un mensaje


ACD monoclonal antibody (M01), clone 1C11-1A7

ACD monoclonal antibody (M01), clone 1C11-1A7