Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ACD monoclonal antibody (M01), clone 1C11-1A7
Abnova
ACD monoclonal antibody (M01), clone 1C11-1A7
Ref: AB-H00065057-M01
ACD monoclonal antibody (M01), clone 1C11-1A7
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a full-length recombinant ACD.
Información adicional
Size
100 ug
Gene Name
ACD
Gene Alias
PIP1|PTOP|TINT1|TPP1
Gene Description
adrenocortical dysplasia homolog (mouse)
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq
MPGRCQSDAAMRVNGPASRAPAGWTSGSLHTGPRAGRPRAQARGVRGRGLLLRPRPAKELPLPRKGGAWAPAGNPGPLHPLGVAVGMAGSGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPRLRVPGCNQDLDVQKKLYDCLEEHLSESTSSNAGLSLS
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ACD (AAH16904, 1 a.a. ~ 544 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
65057
Clone Number
1C11-1A7
Iso type
IgG1 Kappa
Enviar uma mensagem
ACD monoclonal antibody (M01), clone 1C11-1A7
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*