AHRR monoclonal antibody (M01), clone 5G11
  • AHRR monoclonal antibody (M01), clone 5G11

AHRR monoclonal antibody (M01), clone 5G11

Ref: AB-H00057491-M01
AHRR monoclonal antibody (M01), clone 5G11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant AHRR.
Información adicional
Size 100 ug
Gene Name AHRR
Gene Alias AHH|AHHR|KIAA1234|MGC167813|MGC176630|bHLHe77
Gene Description aryl-hydrocarbon receptor repressor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RATAGRSRELTPFHPAHCACLEPTDGLPQSEPPHQLCARGRGEQSCTCRAAEAAPVVKREPLDSPQWATHSQGMVPGMLPKSALATLVPPQASGCTFLP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AHRR (NP_065782, 617 a.a. ~ 715 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57491
Clone Number 5G11
Iso type IgG2a Kappa

Enviar un mensaje


AHRR monoclonal antibody (M01), clone 5G11

AHRR monoclonal antibody (M01), clone 5G11