Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
AHRR monoclonal antibody (M01), clone 5G11
Abnova
AHRR monoclonal antibody (M01), clone 5G11
Ref: AB-H00057491-M01
AHRR monoclonal antibody (M01), clone 5G11
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant AHRR.
Información adicional
Size
100 ug
Gene Name
AHRR
Gene Alias
AHH|AHHR|KIAA1234|MGC167813|MGC176630|bHLHe77
Gene Description
aryl-hydrocarbon receptor repressor
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
RATAGRSRELTPFHPAHCACLEPTDGLPQSEPPHQLCARGRGEQSCTCRAAEAAPVVKREPLDSPQWATHSQGMVPGMLPKSALATLVPPQASGCTFLP
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
AHRR (NP_065782, 617 a.a. ~ 715 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
57491
Clone Number
5G11
Iso type
IgG2a Kappa
Enviar uma mensagem
AHRR monoclonal antibody (M01), clone 5G11
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*